PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Lus10038995
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Malpighiales; Linaceae; Linum
Family bZIP
Protein Properties Length: 709aa    MW: 76970.4 Da    PI: 7.4818
Description bZIP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Lus10038995genomeBGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1bZIP_135.12.9e-11245305262
                  XXXCHHHCHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHH CS
       bZIP_1   2 kelkrerrkqkNReAArrsRqRKkaeieeLeekvkeLeaeNkaLkkeleelkkevaklkse 62 
                  ++ k+  r+++NRe+A+ sRqRKk +++eLeekv ++ +   +L  +++    e a+l+++
  Lus10038995 245 EDEKKKARLMRNRESAQLSRQRKKHYVDELEEKVRAMNSIIADLNGRVSYFMAENATLRQQ 305
                  5679999****************************99998888888888777777777765 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM003381.0E-13244308IPR004827Basic-leucine zipper domain
PROSITE profilePS5021710.082246306IPR004827Basic-leucine zipper domain
PfamPF001705.4E-10247306IPR004827Basic-leucine zipper domain
SuperFamilySSF579592.25E-11248306No hitNo description
Gene3DG3DSA:1.20.5.1702.3E-16248306No hitNo description
CDDcd147041.50E-20249300No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0042538Biological Processhyperosmotic salinity response
GO:0045893Biological Processpositive regulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0005783Cellular Componentendoplasmic reticulum
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 709 aa     Download sequence    Send to blast
MADSTAAFAD ANPPTQPVSF ADPLQTPPLD PLFFSSDPDH DFINDLTFHF DLDDLDPQYF  60
LPDTGDSFLL PDSTTDHADF GSDLPEHDGS LQDFCFDRGN NNRVHVESEN SVISRDGCSY  120
VVGKYFNSSP SQTRSFDSHE RIISSAPAAV TIVNSSAAFP VSSHGSGDGA SGVSETMNVP  180
SPDSKSYPHS LTKLENEEAN GKSKRKKELS DDTIEETTRR QKCKVFETPS NSNPKGETAD  240
CGGDEDEKKK ARLMRNRESA QLSRQRKKHY VDELEEKVRA MNSIIADLNG RVSYFMAENA  300
TLRQQLVGGT PMYPPPPIHY LWMPPGAPYL VQGSKVPLVP IPRLKPQQPA ASTKSKKGET  360
KNPGIRTKKV ASVSFIGLLC FILMFGGLVP LINVKYGGPG ENVAEGNRFS DQHFPGKVLV  420
VHGHSNISSG KTGVGFSGDT IGKMQCQKAK NGCDNSSEHL HASLYVPRND RLVKIDGNLI  480
IQSVLASERT KGDASEATGL AIANQLSGAL AIPEGTIRGK PYRSHAEQQK AIGSRSADKL  540
EEQFKSSAAD GKLQQWFHQG LAGPILSSGV CSEVFQFDMT PSRGAIVAAS SVTNLTREGR  600
QQRASPPEKK KHRRILHALP VPFPTSNLNV TGERKGINNG TTYDVQRSSS SMVVSVLVDP  660
REVGNSEVDG MIVQKSLSRV FIVFLVDGVK YVTYSCVLPR STPHLVRA*
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_011041392.10.0PREDICTED: uncharacterized protein LOC105137361
TrEMBLB9SJN11e-171B9SJN1_RICCO; Transcription factor hy5, putative
STRINGPOPTR_0006s03300.11e-163(Populus trichocarpa)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF74873448
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G40950.11e-124bZIP family protein